Powered by FoodRisk.org

Allergen

ALU66112.1

Accession ALU66112.1
Species Dermatophagoides farinae
Common Name House dust mite
Description peritrophin like protein
IUIS Name Der f 23
Gi
Length 174
Year Adopted 2021
Sequence >ALU66112.1 Allergen Der f 23; peritrophin like protein [Dermatophagoides farinae]
MKFNITIAFVSLAILVHSSYADIDHFDNDDQNSSTSRPDDDPTTMID
VQTTTVQPSSMPTTSESESTVKPTTTTVKPSPTTVKPTTTTVKLTTT
TVKPSPTTVKPTTTTVKPSPTTTTTTTTEQPEDEFECPTRFGYFADP
KDPCKFYICSNWEAIHKSCPGNTRWNEKELTCT
Parent Accession