Powered by FoodRisk.org

Allergen

ANW82807.1

Accession ANW82807.1
Species Polybia paulista
Common Name Neotropical Wasp
Description Venom allergen antigen 5, partial Putative Poly p 5
Gi
Length 206
Year Adopted 2019
Sequence >accession|ANW82807.1|Venom allergen antigen 5, partial Putative Poly p 5 [Polybia paulista]
NKYCNIKCSKVAHTVCQYGESTKPSSKCNKVSITSVGVTEEEKKLIVDEHNRFRQKVAQG
LETRGNPGPQPAASDMNNLVWNDELAYIAQVWASQCQFFVHDKCRNTAQYQVGQNIAYSA
STAAYPGIVSLIVLWENEVKDFNYSQGITKENFSKVGHYTQVVWAKTKEVGCGSIKYIEK
GMKSHYLVCNYGPAGNYMGQPIYTKK
Notes This record (Accession# ANW82807.1) replaces Accession# ADD63684.1 in previous versions of COMPARE; which were imported from AOL v.16 when building the first version of COMPARE