Powered by FoodRisk.org

Allergen

APD76154.1

Accession APD76154.1
Species Juglans regia
Common Name English walnut
Description pathogenesis related protein 10
Gi
Length 160
Year Adopted 2018
Sequence >accession|APD76154.1|pathogenesis related protein 10 [Juglans regia]
MGVFTYETESTSVIPPARLFKAFVLDADNLIPKVVPQAVKSSEIIEGNGGPGTIKKINFG
EGSQYKYVKHRTDAIDEANFTYAYSVIEGDALADKIEKISYETKIVASHEGGSILKSISH
YHSKGDHEIKEEDVKDGKEKASGLFKAVEGYLLAHPDAYN