Powered by FoodRisk.org

Allergen

APR62629.1

Accession APR62629.1
Species Juglans nigra
Common Name Black Walnut
Description 11S globulin/legumin- like protein
IUIS Name Jug n 4
Gi
Length 510
Year Adopted 2018
Sequence >APR62629.1 Allergen Jug n 4; 11S globulin/legumin- like protein [Juglans nigra]
MAKPILLSISLCLVALVNGCLAQSGGRQQPRFGECKLKRLVALEPSNRIEAEAGVIESWD
PNNQQFQCAGVAVVRRTIEPNGLLLPQYSNAPQLLYIVKGRGITGVLFPGCPETFEESQQ
GQSRIRPSLRSASFQRDRHQKIRHFREGDVIAFPAGVAHWCYNDGDTPVVAVALMDTTNN
ANQLDQNPRNFYLAGNPDDEFRPQGQQEYEQHRRQQQHQQRHGEPGQQQRGSGNNVFSGF
DADFLADAFNVDTETARRLQSENDHRRSIVRVEGRQLQVIRPRWSREEQEREERKERERE
RESESERRQSRRGGRDDNGLEETICTLRLRENIGDPSRADIYTEEAGRISTANSHTLPVL
RWLQLSAERGALYSDALYVPHWNLNAHSVVYALRGRAEVQVVDNFGQTVFDDELREGQLL
TIPQNFAVVKRARNEGFEWVSFKTNENAMVSPLAGRTSAIRALPEEVLANALQIPREDAR
RLKFNRQESTLVRSRPSSSRSSRSERRAEV
Parent Accession