Powered by FoodRisk.org

COMPARE Database

ARQ16437.1

Accession ARQ16437.1
Species Artemisia annua
Common Name Sweet Wormwood
Description Art an 7.0101 galactose oxidase
Gi
Length 594
Year Adopted 2019
Sequence >accession|ARQ16437.1|Art an 7.0101 galactose oxidase [Artemisia annua]
MASSIKTVILFLLPLLLAYSVLAAPDITDGGDKPGPEIDDGGGDKPVPGNNDGASDYAKP
AFEPEFMGAWVIDNPNAGVAAMQLQLMPNDQIVWFDTTSLGASGYKLPEGTPCPINPDAN
NQPDCYAHGIAYDWKTSKYRPLTLQGDAWCSSGNLWPNGNLMATGGTFSGDKAIRVIAND
DPKGDFTTKIGALADTRWYSSNQVLPDGSSVVLGGRDSYSYEIVPPQMEFKPKRFDLPFM
QQTTEPPLGPGRPVENNLYPFLFLLPDGNIFLFANNRAITFEPATGKTVKEFPVLPGGSR
NYPPSGSAALFPLKLTADNAPVIPEIVICGGNQPNAYELVDARHVTEKQFLPALQDCNRI
QPMAADAAWIPEQNMPSPRTMGDLIHLANGDMLMLNGAKKGTSGWEDATEANLTPVLYTP
YKPMGQRFKELTPTTIARMYHSCSALLPDTRVLVAGSNMHQFYTFDTEFPTELRVEKFSP
PYLDPALETERTQIDPANTDAVLKYGKPFKITAALMEKQPLVLGEVKVTLLYPPFTTHGF
SQNQRMIVPAITSVQNGVITAVAPPSGQIAPPGYYIMFVSHLGIPGAGIWVHID