Powered by FoodRisk.org

Allergen

ARQ16438.1

Accession ARQ16438.1
Species Artemisia argyi
Common Name Silvery Wormwood; Chinese Mugwort
Description Galactose oxidase
Gi
Length 594
Year Adopted 2019
Sequence >accession|ARQ16438.1|Galactose oxidase [Artemisia argyi]
MASSIKTVILFLLPLLLAYSVLAAPDITDGGDKPGPQVDDGGGDKPVPGNNDGASDYAKP
AFEPEFMGAWVIDNPNAGVAAMQLQLMPNDQIVWFDTTSLGASGYKLPEGTPCPNNPDAN
NQPDCYVHGIAYDWKTSKYRPLTLQGDAWCSSGNLWPNGNLMATGGTFSGDKAIRVIAND
DPNGDFTTKIGALADTRWYSSNQVLPDGSSVVLGGRDSYSYEIVPPQMEFKPRRFDLPFM
QQTTEPPLGPGRPVENNLYPFLFLLPDGNIFLFANNRAITFEPATGKTVKEFPVLPGGSR
NYPPSGSAALFPLKLTADNAPVIPEIVICGGNKPNAYELVDARHVTEKQFLPALQDCNRI
QPMAADAAWIPEQNMPSPRTMGDLIHLANGDMLMLNGAKKGTSGWEDATEANLTPVLYTP
YKPMGQRFKELSPTTIARMYHSCSALLPDTRVLVAGSNMHQFYTFDTEFPTELRVEKFSP
PYLDPALEPERTQIDPANTDVVLKYGKPFKITAALMEKQPLVLGEVKVTLLYPPFTTHGF
SQNQRMIVPAITSVENGVITAIAPPSGEIAPPGYYIMFVSHLGIPGAGIWVHID