Powered by FoodRisk.org

COMPARE Database

ARQ16439.1

Accession ARQ16439.1
Species Artemisia capillaris
Common Name Capillary Wormwood; Mugwort
Description Galactose oxidase
Gi
Length 594
Year Adopted 2019
Sequence >accession|ARQ16439.1|Galactose oxidase [Artemisia capillaris]
MASSIKTAILFLLPLLLAYSVLAAPDITDGGDKPGPLIDDGGGDKPVPGNNDGASDYAKP
AIEPEFMGEWVIDNPNAGVAAMQLQLMPNDQIVWFDTTSLGASGYKLPEGTPCPINPDAN
NQPDCYAHGIAYDWKTSKYRPLTLQGDAWCSSGNLWPNGNLMATGGTFSGDKAIRVIAND
DPNGDFTTKIGALADTRWYSSNQVLPDGSAVVLGGRDSYSYEIVPPQMEFKPKRFDLPFL
QQTTEPPLGPGRPVENNLYPFQFLLPDGNIFLFANNRAITFEPATGKTVKEFPVLPGGSR
NYPPSGSAALFPLKLTADNAPVVPEIVICGGNQPNAYELVDARHVTEKKFLPALQDCNRI
QPMAADAAWIPEQNMPSPRTMGDLLHLANGDMLMLNGAKKGTSGWEDATEANLTPVLYTP
YKPMGQRFKELSPTTIARMYHSCSALLPDTRVLVAGSNMHQFYTFDTEFPTELRVEKFSP
PYLDPALEPERTLIDPANTDVVLKYGKPFKITAALMEKQPLVLGEVKVTLLYPPFTTHGF
SQNQRMIVPAITGVENGVITAVAPPSGEIAPPGYYIMFVSHLGIPGAGIWVHID