Powered by FoodRisk.org

Allergen

ARQ16440.1

Accession ARQ16440.1
Species Artemisia gmelinii
Common Name Wormwood; Mugwort
Description Galactose oxidase
Gi
Length 594
Year Adopted 2019
Sequence >accession|ARQ16440.1|Galactose oxidase [Artemisia gmelinii]
MASSIKTVILFLLPLLLAYSVLAAPDITDGGDKPGPEIDDGGGDKPVPGNNDGASDYAKP
AIEPEFMGAWVIDNPNAGVAAMQLQLMPNDQIVWFDTTSLGPSGYKLPEGTPCPINPDAN
NQPDCYAHGIAYDWKTSKYRPLTLQGDAWCSSGNLWPNGNLMATGGTFSGDKAIRVIAND
DPKGDFTTKIGALADTRWYSSNQVLPDGSSVVLGGRDSYSYEIVPPQMEFKPKRFDLPFM
QQTTEPPLGPGRPVENNLYPFLFLLPDGNIFLFANNRAITFEPATGKTVKEFPVLPGGSR
NYPPSGSAALFPLKLTADNAPVIPEIVICGGNQPNAYELVDARHVTEKQFLPALQDCNRI
QPMAADAAWIPEQNMPSPRTMGDLIHLANGDMLMLNGAKKGTSGWEDATEANLTPVLYTP
YKPMGQRFKELTPTTIARMYHSCSALLPDTRVLVAGSNMHQFYTFDTEFPTELRVEKFSP
PYLDPALETERTQIDPANTDVVLKYGKPFKITAALMEKQPLVLGEVKVTLLYPPFTTHGF
SQNQRMIVPAITSVENGVITAVAPPSGQIAPPGYYIMFVSHLGIPGAGIWVHID