Powered by FoodRisk.org

Allergen

ARQ16441.1

Accession ARQ16441.1
Species Artemisia lavandulifolia
Common Name Wormwood; Mugwort
Description Galactose oxidase
Gi
Length 594
Year Adopted 2019
Sequence >accession|ARQ16441.1|Galactose oxidase [Artemisia lavandulifolia]
MASSIKTVILFLLPLLLAYSVLAAPDITDGGDKPGPQVDDGGGDKPVPGNNDGASDYAKP
AFEPEFMGAWVIDNPNAGVAAMQLQLMPNDQIVWFDTTSLGASGYKLPEGTPCPNNPDAN
NQPDCYVHGIAYDWKTSKYRPLTLQGDAWCSSGNLWPNGNLMATGGTFSGDKAIRVIAND
DPNGDFTTKIGALADTRWYSSNQVLPDGSSVVLGGRDSYSYEIVPPQMEFKPRRFDLPFM
QQTTEPPLGPGRPVENNLYPFLFLLPDGNIFLFANNRAITFEPATGKTVKEFPVLPGGSR
NYPPSGSAALFPLKLTADNAPVIPEIVICGGNKPNAYELVDARHVTEKQFLPALQDCNRI
QPMAADAAWIPEQNMPSPRTMGDLIHLANGDMLMLNGAKKGTSGWEDATEANLTPVLYTP
YKPMGQRFKELSPTTIARMYHSCSALLPDTRVLVAGSNMHQFYTFDTEFPTELRVEKFSP
PYLDPALEPERTQIDPANTDVVLKYGKPFKITAALMEKQPLVLGEVKVTLLYPPFTTHGF
SQNQRMIVPAITSVENGVITAIAPPSGEIAPPGYYILFVSHLGIPGAGIWVHID