Powered by FoodRisk.org

Allergen

ARQ16442.1

Accession ARQ16442.1
Species Artemisia sieversiana
Common Name Wormwood; Mugwort
Description Galactose oxidase
Gi
Length 595
Year Adopted 2019
Sequence >accession|ARQ16442.1|Galactose oxidase [Artemisia sieversiana]
MASSIKTVILFLLPLLLAYSILAAPDITDGAGDKPGPQVDDGGGDKPVPGNNDGASDYAK
PAIESEFMGQWVIDNPNAGVAAMQLQLMPNDQIVWFDTTSLGASGYKLPEGTPCPINPDA
NNQPDCYVHGIAYDWKTSKYRPLTLQGDAWCSSGNLWPNGNLMATGGTFSGDKAIRVIPN
DDPNGDFTTKIGALADTRWYSSNQVLPDGSSVVLGGRDSYSYEIVPPQMEFKPKRFDLPF
MQQTTEPPLGPGRPVENNLYPFLFLLPDGNIFLFANNRAITFEPATGKTVKEFPVLPGGS
RNYPPSGSAALFPLKLTADNAPVVPEIVICGGNQPNAYELVDARHVTEKQFLPALQDCNR
IKPMAADAAWIPEQNMPSPRTMGDLIHLANGDMLMLNGAKKGTSGWEDATEPNLTPVLYT
PYKPMGQRFKELRPTTIARMYHSCSALLPDTRVLVAGSNMHQFYTFDTEFPTELRVEKFS
PPYLDPALELERSQIDPANTDVVLKYGKPFKITAGLMEKQPLVLGEVKVTLLYPPFTTHG
FSQNQRMIVPAITSVENGVITAIAPPSGEIAPPGYYIMFVSHLGIPGAGIWVHID