Powered by FoodRisk.org

COMPARE Database

ARQ16443.1

Accession ARQ16443.1
Species Artemisia vulgaris
Common Name Mugwort
Description Galactose oxidase
Gi
Length 594
Year Adopted 2019
Sequence >accession|ARQ16443.1|Galactose oxidase [Artemisia vulgaris]
MASSIKTVVLFLLPLLLAYSVLAAPDITDGGDKPGPQVDDGGGDKPVPGNNDGASDYAKP
AFEPEFMGAWVIDNPNAGVAAMQLQLMPNDQIVWFDTTSLGASGYKLPEGTPCPNNPDAN
NQPDCYVHGIAYDWKTSKYRPLTLQGDAWCSSGNLWPNGNLMATGGTFSGDKAIRVIAND
DPNGDFTTKIGALADTRWYSSNQVLPDGSSVVLGGRDSYSYEIVPPQMEFKPRRFDLPFM
QQTTEPPLGPGRPVENNLYPFLFLLPDGNIFLFANNRAITFEPATGKTVKEFPVLPGGSR
NYPPSGSAALFPLKLTADNAPVIPEIVICGGNKPNAYELVDARHVTEKQFLPALQDCNRI
QPMAADAAWIPEQNMPSPRTMGDLIHLANGDMLMLNGAKKGTSGWEDATEANLTPVLYTP
YKPMGQRFKELSPTTIARMYHSCSALLPDTRVLVAGSNMHQFYTFDTEFPTELRVEKFSP
PYLDPALEPERTQIDPANTDVVLKYGKPFKITAALMEKQPLVLGEVKVTLLYPPFTTHGF
SQNQRMIVPAITSVENGVITAIAPPSGEIAPPGYYIMFLSHLGIPGAGIWVHID