Powered by FoodRisk.org

Allergen

ATI08931.1

Accession ATI08931.1
Species Dermatophagoides farinae
Common Name American House Dust Mite
Description Der f 36
Gi
Length 229
Year Adopted 2019
Sequence >accession|ATI08931.1|Der f 36 [Dermatophagoides farinae]
MKFYNILTVATIVILVAFFDNVHADSQAQEQCRQLHHVDIDPSGTKFLNNNCRLNCNIHG
QIYGHNINEGRTCMIGQTNYVCQNGECVGHNRQHVGHIDIELISASLYEKANAYATVCIM
NNSLPISLPIQDRRNCISCSTHVKENTNYPVWNEVCVGSSNYLFVSDSRVTTEVWDHHGS
NNNVFLGGVTLTIDQLVNHGDNHRQINLAMAGGHNPGQLSTRITWTQRT