Powered by FoodRisk.org

COMPARE Database

ATI08932.1

Accession ATI08932.1
Species Dermatophagoides pteronyssinus
Common Name European House Dust Mite
Description Der p 36
Gi
Length 227
Year Adopted 2019
Sequence >accession|ATI08932.1|Der p 36 [Dermatophagoides pteronyssinus]
MKFYNVLTITIGVILLSVFDNVQADTVAQEQCRQLHHVDVDPSGTQFLNNNCLLDCNIHG
KIYSHNMNEGRTCMVGRTNYVCRNGQCVGNNQHVGHVDIELISASLYEKANAYASVCIKN
NSMPISLPIQDRRDCITCSTQVRSNTNNPIWNEVCTGSGNYLLVSDSRVAIEVWNHLGTS
NNIFLGGVSLTIDQLVNHGDNHRAINLAMAGNKPGQLTTRITWTQRN