Powered by FoodRisk.org

Allergen

AUW37958.1

Accession AUW37958.1
Species Periplaneta americana
Common Name American Cockroach
Description Per a 5.0101 glutathione S transferase class delta
IUIS Name
Gi
Length 216
Year Adopted 2019
Sequence >AUW37958.1 Per a 5.0101 glutathione S transferase class delta [Periplaneta americana]
MTIDFYYLPGSAPCRSVLLAAKAIGVDLNLKVTNLMAGEHLTPEFLKMNPQHTIPTLNDN
GFCLWESRAILSYLADQYGKDDSLYPKDAKKRALVDQRLYFDIRTLYHRFGEYYYPIYFA
KQAADPEKMKKLEEAFEFLNKFLESQEFVAGNKLTIADLAIVSSVSTADIMGFDVSKYSN
VAKWFEKCKKIVPGYEELNHSGCLKFKEMCDNLAKK
Parent Accession