Powered by FoodRisk.org

Allergen

B3EWP3.1

Accession B3EWP3.1
Species Arachis hypogaea
Common Name Peanut
Description Defensin 1;Ara h 12
Gi 1018736824
Length 71
Year Adopted 2017
Sequence >accession|B3EWP3.1|Defensin 1;Ara h 12 [Arachis hypogaea]
KTVAGFCIFFLVLFLAQEGVVKTEAKLCNHLADTYRGPCFTNASCDDHCKNKEHFVSGTC
MKMACWCAHNC