Powered by FoodRisk.org

Allergen

B3EWP4.1

Accession B3EWP4.1
Species Arachis hypogaea
Common Name Peanut
Description Defensin 2; Ara h 13.0101
Gi 1018736830
Length 79
Year Adopted 2017
Sequence >accession|B3EWP4.1|Defensin 2; Ara h 13.0101 [Arachis hypogaea]
VQKRTIIMEKKMAGFCIFFLILFLAQEYGVEGKECLNLSDKFKGPCLGSKNCDHHCRDIE
HLLSGVCRDDFRCWCNRKC