Allergen

BAA09632.1

Accession BAA09632.1
Species Brassica napus
Common Name Rape
Description polcalcin, partial sequence
IUIS Name
Gi
Length 79
Year Adopted 2021
Sequence >BAA09632.1 polcalcin, partial sequence [Brassica napus]
MADAEHERIFKKFDTDGDGKISAAELEEALKKLGSVTPDDVT
RMMAKIDTDGDGNISFQEFTEFASANPGLMKDVAKVF
Parent Accession