Powered by FoodRisk.org

Allergen

BAB15802.1

Accession BAB15802.1
Species Glycine max
Common Name Soybean
Description glycinin/11S globulin
IUIS Name Gly m 6
Gi 0010566449
Length 517
Year Adopted 2015
Sequence >BAB15802.1 Allergen Gly m 6; glycinin/11S globulin [Glycine max]
MGKPFFTLSLSSLCLLLLSSACFAITSSKFNECQLNNLNALEPDHRVESEGGLIETWNSQ
HPELQCAGVTVSKRTLNRNGLHLPSYSPYPQMIIVVQGKGAIGFAFPGCPETFEKPQQQS
SRRGSRSQQQLQDSHQKIRHFNEGDVLVIPPGVPYWTYNTGDEPVVAISLLDTSNFNNQL
DQNPRVFYLAGNPDIEHPETMQQQQQQKSHGGRKQGQHQQQEEEGGSVLSGFSKHFLAQS
FNTNEDTAEKLRSPDDERKQIVTVEGGLSVISPKWQEQEDEDEDEDEEYEQTPSYPPRRP
SHGKHEDDEDEDEEEDQPRPDHPPQRPSRPEQQEPRGRGCQTRNGVEENICTMKLHENIA
RPSRADFYNPKAGRISTLNSLTLPALRQFGLSAQYVVLYRNGIYSPHWNLNANSVIYVTR
GKGRVRVVNCQGNAVFDGELRRGQLLVVPQNFVVAEQGGEQGLEYVVFKTHHNAVSSYIK
DVFRAIPSEVLSNSYNLGQSQVRQLKYQGNSGPLVNP
Parent Accession