Allergen

BAB55663.1

Accession BAB55663.1
Species Oncorhynchus mykiss
Common Name rainbow trout
Description collagen alpha 2 chain
IUIS Name
Gi
Length 1356
Year Adopted 2020
Sequence >BAB55663.1 collagen alpha 2 chain [Oncorhynchus mykiss]
MLSFVDNRILLLLAVTSLLASCQSGGLKGPRGAKGPRGDRGPQGPNGRDGKAGLPGIAGP
PGPPGLGGNFAAQFDGGKGSDPGPGPMGLMGSRGPNGPPGAPGPQGFTGHAGEPGEPGQT
GSIGARGPTGSAGKPGEDGNNGRPGKPGDRGGPGTQGARGFPGTPGLPGMKGHRGYNGLD
GRKGESGTAGAKGETGAHGANGSPGPAGSRGLNGERGRAGPAGPAGARGADGSTGPAGPA
GPLGAAGPPGFPGAPGPKGEIGGAGSNGPSGPQGGRGEPGINGAVGPVGPVGNPGNNGIN
GAKGAAGLPGVAGAPGFPGPRGGPGPQGPQGSTGARGLGGDPGPSGQKGDSGAKGEPGHS
GVQGAAGPAGEEGKRGSTGEVGATGPAGLRGARGGAGTRGLPGLEGRGGPIGMPGARGAT
GPGGIRGAPGDAGRAGESGLTGARGLPGNSGQGGPPGKEGPPGAAGLDGRTGPPGPTGPR
GQPGNIGFPGPKGPGGEAGKGGDKGPTGATGLRGGPGADGNNGAPGPAGVVGNTGEKGEQ
GPAGAPGFQGLPGPAGPAGEAGKAGNQGMPGDQGLPGPAGVKGERGNSGPAGSAGSQGAI
GARGPAGTPGPDGGKGEPGSVGIVGAAGHQGPGGMPGERGAGGTPGPKGEKGEGGHRGLE
GNMGRDGARGGPGPSGPPGPSGANGEKGESGSFGPAGPAGLRGPSGERGEGGPAGLPGFA
GPPGSDGQSGPRGEKGPAGGKGDVGPAGPAGPSGQSGPSGASGPAGPPGGRGDAGPSGLT
GFPGAAGRVGGPGPAGIAGPPGSAGPAGKDGPRGLRGDPGPGGPQGEQGVVGPAGISGDK
GPSGESGPPGAPGTAGPQGVLGPSGFVGLPGSRGDKGLPGGPGAVGEPGRLGPAGASGPR
GPAGNIGMPGMTGTQGEAGREGNSGNDGPPGRPGAAGFKGDRGEPGSPGALGSSGQPGPN
GPAGSAGRPGNRGESGPTGNGGPVGAVGARGAPGPAGPRGEKGGAGEKGDRGMKGLRGHG
GLQGMPGPNGPSGETGSAGITGPAGPRGPAGPHGPPGKDGRAGGHGAIGPVGHRGSPGHL
GPAGPPGSPGLPGPAGPAGGGYDQSGGYDEYRADQPSFRAKDYEVDATIKSLNSQIENLL
TPEGSKKNPARTCRDIRLSHPDWSSGFYWIDPNQGCIADAIKAYCDFSTGHTCIHPHPES
IARKNWYRSSENKKHVWFGETINGGTEFAYNDETLSPQSMATQLAFMRLLANQATQNITY
HCKNSVAYMDGENGNLKKAVLLQGSNDVELRAEGNSRFTFNVLEDGCTRHTGQWSKTVIE
YRTNKPSRLPILDIAPLDIGEADQEFGLDIGPVCFK
Parent Accession