Powered by FoodRisk.org

Allergen

BAC23082.1

Accession BAC23082.1
Species Cryptomeria japonica
Common Name Japanese cedar
Description allergen Cry j 2 [Cryptomeria japonica]
Gi 0024898904
Length 514
Year Adopted 2007
Sequence >accession|BAC23082.1|Allergen allergen Cry j 2 [Cryptomeria japonica]
MAMKFIAPMAFVAMQLIIMAAAEDQSAQIMLDSDIEQYLRSNRSLRKVEHSRHDAINIFN
VEKYGAVGDGKHDCTEAFSTAWQAACKKPSAMLLVPGNKKFVVNNLFFNGPCQPHFTFKV
DGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWWAGQCKWVNGREICNDR
DRPTAIKFDFSTGLIIQGLKLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTDGIDIFA
SKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEVSYVHVN
GAKFIDTQNGLRIKTWQGGSGMASHIIYENVEMINSENPILINQFYCTSASACQNQRSAV
QIQDVTYKNIRGTSATAAAIQLKCSDSMPCKNINLSDISLKLTSGKIASCLNDNANGYFS
GHVIPACKNLSPSAKRKESKSHKHPKTVMVENMGAYDKGNRTRILLGSRPPNCTNKCHGC
SPCKAKLVIVHRIMPQEYYPQRWMCSCHGKIYHP