Powered by FoodRisk.org

Allergen

BAC23084.1

Accession BAC23084.1
Species Cryptomeria japonica
Common Name Japanese cedar
Description allergen Cry j 2 [Cryptomeria japonica]
Gi 0024898908
Length 514
Year Adopted 2007
Sequence >accession|BAC23084.1|Allergen allergen Cry j 2 [Cryptomeria japonica]
MAMKLIAPMAFLAMQLIIMAAAEDQSAQIMLDSVVEKYLRSNRSLRKVEHSRHDAINIFN
VEKYGAVGDGKHDCTEAFSTAWQAACKKPSAMLLVPGNKKFVVNNLFFNGPCQPHFTFKV
DGIIAAYQNPASWKNNRIWLQFAKLTGFTLMGKGVIDGQGKQWWAGQCKWVNGREICNDR
DRPTAIKFDFSTGLIIQGLRLMNSPEFHLVFGNCEGVKIIGISITAPRDSPNTDGIDIFA
SKNFHLQKNTIGTGDDCVAIGTGSSNIVIEDLICGPGHGISIGSLGRENSRAEVSYVHVN
GAKFIDTQNGLRIKTWQGGSGMASHIIYENVEMINSENPILINQFYCTSASACQNQRSAV
QIQDVTYKNIRGTSATAAAIQLKCSDSMPCKDIKLSDISLKLTSGKIASCLNDNANGYFS
GHVIPACKNLSPSAKRKESKSHKHPKTVMVENMRAYDKGNRTRILLGSRPPNCTNKCHGC
SPCKAKLVIVHRIMPQEYYPQRWICSCHGKIYHP