Powered by FoodRisk.org

Allergen

BAC76688.1

Accession BAC76688.1
Species Triticum aestivum
Common Name Wheat
Description 27K protein [Triticum aestivum]
Gi 0030793446
Length 203
Year Adopted 2007
Sequence >accession|BAC76688.1|Putative 27K protein [Triticum aestivum]
GDVATGRGSEKVHVAIYYESLCPYSVRFVANHLFKAYRDGLLDAANLTLVPYGNAVVRND
GTISCQHGPEECLLNTVEACAIDAWPDVKVHLGFIYCVSDLVLKNKHREWESCFQKQGLD
PKPVTECYKGERGHNLSLEYGRQTAELVPPHQFVPWVVVDGKPLYNDYGNFKAYICKAYK
GYPLLEACRSLGLEAHDDVYGRL