Powered by FoodRisk.org

Allergen

BAC76688.1

Accession BAC76688.1
Species Triticum aestivum
Common Name Wheat
Description thiol reductase
IUIS Name Tri a 27
Gi 0030793446
Length 203
Year Adopted 2007
Sequence >BAC76688.1 Allergen Tri a 27; thiol reductase [Triticum aestivum]
GDVATGRGSEKVHVAIYYESLCPYSVRFVANHLFKAYRDGLLDAANLTLVPYGNAVVRND
GTISCQHGPEECLLNTVEACAIDAWPDVKVHLGFIYCVSDLVLKNKHREWESCFQKQGLD
PKPVTECYKGERGHNLSLEYGRQTAELVPPHQFVPWVVVDGKPLYNDYGNFKAYICKAYK
GYPLLEACRSLGLEAHDDVYGRL
Parent Accession