Powered by FoodRisk.org

Allergen

BAF45320.1

Accession BAF45320.1
Species Cryptomeria japonica
Common Name Japanese cedar
Description allergen Cry j 2 [Cryptomeria japonica]
Gi 0123299282
Length 65
Year Adopted 2009
Sequence >accession|BAF45320.1|Allergen allergen Cry j 2 [Cryptomeria japonica]
MAMKLIAPMAFLAMQLIIMAAAEDQSAQIMLDSVVEKYLRSNRSLRRVEHSRHDAINIFN
VEKYG