Powered by FoodRisk.org

Allergen

BAM22586.1B

Accession BAM22586.1B
Species Gadus chalcogrammus
Common Name walleye pollock
Description vitellogenin A, partial sequence
IUIS Name
Gi
Length 274
Year Adopted 2021
Sequence >BAM22586.1B vitellogenin A, partial sequence [Gadus chalcogrammus]
QVYEAQCSYAKNTLTTFNNRRYKNEMPLSCNQVLAQDCSKELKFMVLLKKDNIE
QNWINVKLADIDIDLYPENDNMIVKVNGMQIPISNLPYQHPTGTIQIKSNGEGI
SVYAASHGLHEVYFDRSSWKVKLADWMKGQTCGICGKADGEVRQEFRTPNGQLA
KDAVSYAHSWVIPAENCQDASECRMRQESVKLEKQIMVHGQESNCHSVETVLRC
LPGCIPVKTTPVTVGFHCLPISAEQQRSGDLSSVLEQSVDLRESVMAHLACNCA
NLCA
Parent Accession BAM22586.1