Powered by FoodRisk.org

Allergen

BAO50872.1

Accession BAO50872.1
Species Fagopyrum esculentum
Common Name Buckwheat
Description 13S globulin [Fagopyrum esculentum]
Gi 0584592120
Length 453
Year Adopted 2015
Sequence >accession|BAO50872.1|Putative 13S globulin [Fagopyrum esculentum]
MLLGVLLCIMVSLAASETRTRGSSTMRARQCRLDQLTSSQPNQKIRSEGGTIEVWDEEED
QFQCAGVAAMRVTVQPDSLSLPSYYSSPRLVYVEQGEGVFGLSLPGCPETYQSRGMEMRG
DEEEEEGFESGRRMTDAHQPTRRVRKGDVVALPQGTVHWCFNDGQEDLVVVAVHNLNTDA
NQLDQSLKTFFLAGGVQGGSKEGKSQKLNFNNILSAFETKLLAEALGTEEETVRKMQESD
ERGPIVKARKNMRQMVTPPRFGREQDEDETNGLEESFCNMRFRHNLGPRTEADIASRQAG
RIHSVDQNKLPILEFIDMSAEKGHLLPNAMLAPAWPLSGHRVFYVLRGEAQMQIVDDNGQ
TVLDDRVSEGSMVVIPQFYISTCRAGRDGLEYVSFETTANPMSSPLNGHASVFKGMPIPV
LSNSYQISPRAAYELKQTRSHEHGLFSPFGGRS