Powered by FoodRisk.org

Allergen

BAT62430.1

Accession BAT62430.1
Species Anisakis simplex
Common Name Nematode
Description Ani s 14
Gi 0957554293
Length 217
Year Adopted 2017
Sequence >accession|BAT62430.1|Ani s 14 [Anisakis simplex]
MQVKCIAKYGEQFCSSMLSVCSSMLSIPWKNDSVQRLPPGIVGCAQTTDPVVQCRAKYSE
SFCNRLGAACSKVTGTDIPAFSRGGGEYRLPEAISQCIAQENIVAMCYASKCSQQCDGWR
VTCNINGGMAQLTPEQVTCFEKQSGLVALKTSCRTNPLNAQCRQIREPFETPKCTTAIPY
LKISQTVINGQIHVQQLVSGGMTGVQVSKTVETVIKT