Powered by FoodRisk.org

Allergen

C0HJZ1.1

Accession C0HJZ1.1
Species Arachis hypogaea
Common Name Peanut
Description Defensin 3; Ara h 13.0102
Gi 1018736837
Length 72
Year Adopted 2017
Sequence >accession|C0HJZ1.1|Defensin 3; Ara h 13.0102 [Arachis hypogaea
MEKKMAGFCIFFLVLFLAQEYGVEGKVCLNLSDKFKGPCLGTKNCDHHCRDIEHLLSGVC
RDDFRCWCNRNC