Allergen

CAA09938.2

Accession CAA09938.2
Species Chironomus kiiensis
Common Name Midge
Description tropomyosin
IUIS Name Chi k 10
Gi 0007321108
Length 285
Year Adopted 2007
Sequence >CAA09938.2 Allergen Chi k 10; tropomyosin [Chironomus kiiensis]
MDAIKKKMQAMKLEKDNALDRALLCENQARDANLRAEKAEEEARTLQKKIQTIENDLDQT
QGQETLVNGKLEGKEKALQNAESEVAALNRRIQLLGEDLDRSEERLASATAKLSEASAAA
DESERARKILENRSLADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAE
ERAEAGEAKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAE
FAERSVQKLQKEVDRLEDELVSEKEKYREIGDDLDTAFVELILKE
Parent Accession