Allergen

CAA11041.1

Accession CAA11041.1
External DB Link NCBI Protein
Species Hevea brasiliensis
Common Name Para rubber tree
Description patatin
IUIS Name Hev b 7
Length 388
Year Adopted 2007
Sequence >CAA11041.1 Hev b 7 patatin [Hevea brasiliensis]
MATGSTTLTQGKKITVLSIDGGGIRGIIPGIILASLESKLQDLDGPDARIADYFDIIAGT
STGGLITTMLTAPNEDKKPMYQAKDIKDFYLENCPKIFPKESRDNYDPIHSIGPIYDGEY
LRELCNNLLKDLTVKDTLTDVIIPTFDIKLLLPVIFSSDDAKCNALKNARLADVCISTSA
APVLLPAHSFTTEDDKNIHTFELIDGGAAATNPTLLALTHIRNEIIRQNPRFIGANLTES
KSRLVLSLGTGKSEYKEKYNADMTSKWRLYNWALYNGNSPAVDIFSNASSDMVDFHLSAL
FKSLDCEDYYLRIQDDTLTGEESSGHIATEENLQRLVEIGTRLLEKQESRINLDTGRLES
IPGASTNEAAITKFAKLLSEERKLRQLK
Parent Accession

Related Articles

Pubmed Authors Title Journal
9692921 Sowka,S.; Wagner,S.; Krebitz,M.; Arija-Mad-Arif,S.; Yusof,F.; Kinaciyan,T.; Brehler,R.; Scheiner,O.; Breiteneder,H. cDNA cloning of the 43-kDa latex allergen Hev b 7 with sequence similarity to patatins and its expression in the yeast Pichia pastoris Eur. J. Biochem. 255 (1), 213-219 (1998)
8732238 Beezhold,D.H.; Sussman,G.L.; Liss,G.M.; Chang,N.S. Latex allergy can induce clinical reactions to specific foods Clin. Exp. Allergy 26 (4), 416-422 (1996)
10589016 Sowka,S.; Hafner,C.; Radauer,C.; Focke,M.; Brehler,R.; Astwood,J.D.; Arif,S.A.; Kanani,A.; Sussman,G.L.; Scheiner,O.; Beezhold,D.H.; Breiteneder,H. Molecular and immunologic characterization of new isoforms of the Hevea brasiliensis latex allergen hev b 7: evidence of no cross-reactivity between hev b 7 isoforms and potato patatin and proteins from avocado and banana J. Allergy Clin. Immunol. 104 (6), 1302-1310 (1999)
12642845 Bernstein DI; Biagini RE; Karnani R; Hamilton R; Murphy K; Bernstein C; Arif SA; Berendts B; Yeang HY In vivo sensitization to purified Hevea brasiliensis proteins in health care workers sensitized to natural rubber latex. J Allergy Clin Immunol. 2003 Mar;111(3):610-6
15627782 Wagner S; Breiteneder H Hevea brasiliensis latex allergens: current panel and clinical relevance. Int Arch Allergy Immunol. 2005 Jan;136(1):90-7
10828719 Yip L; Hickey V; Wagner B; Liss G; Slater J; Breiteneder H; Sussman G; Beezhold D Skin prick test reactivity to recombinant latex allergens. Int Arch Allergy Immunol. 2000 Apr;121(4):292-9