Allergen

CAA32835.1

Accession CAA32835.1
External DB Link NCBI Protein
Species Bos taurus
Common Name cow
Description beta-lactoglobulin
IUIS Name Bos d 5
Length 178
Year Adopted 2007
Sequence >CAA32835.1 Bos d 5; beta-lactoglobulin [Bos taurus]
MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVE
ELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLL
VCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Parent Accession

Related Articles

Pubmed Authors Title Journal
3443305 Jamieson,A.C.; Vandeyar,M.A.; Kang,Y.C.; Kinsella,J.E.; Batt,C.A. Cloning and nucleotide sequence of the bovine beta-lactoglobulin gene Gene 61 (1), 85-90 (1987)
2701948 Alexander,L.J.; Hayes,G.; Pearse,M.J.; Beattie,C.W.; Stewart,A.F.; Willis,I.M.; Mackinlay,A.G. Complete sequence of the bovine beta-lactoglobulin cDNA Nucleic Acids Res. 17 (16), 6739 (1989)
15672476 Natale M; Bisson C; Monti G; Peltran A; Garoffo LP; Valentini S; Fabris C; Bertino E; Coscia A; Conti A Cow Mol Nutr Food Res. 2004 Oct;48(5):363-9
11729348 Jarvinen KM; Chatchatee P; Bardina L; Beyer K; Sampson HA IgE and IgG binding epitopes on alpha-lactalbumin and beta-lactoglobulin in cow Int Arch Allergy Immunol. 2001 Oct;126(2):111-8
16776682 Bernasconi E; Fritsche R; Corthesy B Specific effects of denaturation, hydrolysis and exposure to Lactococcus lactis on bovine beta-lactoglobulin transepithelial transport, antigenicity and allergenicity. Clin Exp Allergy. 2006 Jun;36(6):803-14
18001429 Calvani M; Alessandri C; Frediani T; Lucarelli S; Miceli Sopo S; Panetta V; Zappalã D; Zicari AM Correlation between skin prick test using commercial extract of cow Pediatr Allergy Immunol. 2007 Nov;18(7):583-8