Powered by FoodRisk.org

Allergen

CAA38097.1

Accession CAA38097.1
Species Ricinus communis
Common Name Castor bean
Description 2S albumin precursor [Ricinus communis]
Gi 0000021068
Length 258
Year Adopted 2015
Sequence >accession|CAA38097.1|Allergen 2S albumin precursor [Ricinus communis]
MAKLIPTIALVSVLLFIIANASFAYRTTITTIEIDESKGEREGSSSQQCRQEVQRKDLSS
CERYLRQSSSRRSPGEEVLRMPGDENQQQESQQLQQCCNQVKQVRDECQCEAIKYIAEDQ
IQQGQLHGEESERVAQRAGEIVSSCGVRCMRQTRTNPSQQGCRGQIQEQQNLRQCQEYIK
QQVSGQGPRRSDNQERSLRGCCDHLKQMQSQCRCEGLRQAIEQQQSQGQLQGQDVFEAFR
TAANLPSMCGVSPTECRF