Powered by FoodRisk.org

Allergen

CAA46782.1

Accession CAA46782.1
Species Brassica rapa
Common Name Turnip
Description 2S storage protein [Brassica rapa]
Gi 0000017697
Length 178
Year Adopted 2009
Sequence >accession|CAA46782.1|Putative 2S storage protein [Brassica rapa]
MANKLFLVSATLALFFLLTNASVYRTGSEFDEHDATNPAGPFRIPKCRKEFQQAQHLKAC
QQWLHKQAMQSGSGPSWTLDGEFDFEEDMENTQGPQQEPPLLQQCCNELHQEEPLCVCPT
LKGASKAVKQQVRQQGQQQQMQQVISRIYQTSTHLPRVCNIRQVSICPFQKTMPGPSY