Powered by FoodRisk.org

Allergen

CAA47357.1

Accession CAA47357.1
Species Carpinus betulus
Common Name Hornbeam
Description Car b I [Carpinus betulus]
IUIS Name
Gi 0000402745
Length 159
Year Adopted 2007
Sequence >CAA47357.1 Allergen Car b I [Carpinus betulus]
GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQAISSVENVGGNGGPGTIKNITFAE
GSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKF
HAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Parent Accession