Allergen

CAA51718.1

Accession CAA51718.1
Species Zea mays
Common Name Corn
Description profilin
IUIS Name Zea m 12
Gi 0000313138
Length 131
Year Adopted 2015
Sequence >CAA51718.1 Allergen Zea m 12; profilin [Zea mays]
MSWQTYVDEHLMCEIEGHHLTSAAIVGHDGATWAQSTAFPEFKPEEMAAIMKDFDEPGHL
APTGLILGGTKYMVIQGEPGAVIRGKKGSGGITVKKTGQSLIIGIYDEPMTPGQCNLVVE
RLGDYLLEQGM
Parent Accession