Allergen

CAA51720.1

Accession CAA51720.1
Species Zea mays
Common Name Corn
Description profilin
IUIS Name Zea m 12
Gi 0000313142
Length 131
Year Adopted 2015
Sequence >CAA51720.1 Allergen Zea m 12; profilin [Zea mays]
MSWQTYVDEHLMCEIEGHHLSSAAIVGHDGAVWAQSTAFPQFKPEEMTNIIKDFDEPGFL
APIGLFLGPTKYMVIQGEPGAVIRGKKGSGGITVKKTGQALVIGIYDEPMTPGQCNMVVE
RLGDYLVEQGL
Parent Accession