Powered by FoodRisk.org

Allergen

CAA54694.1

Accession CAA54694.1
Species Betula pendula
Common Name European white birch
Description 1-Sc1 [Betula pendula]
Gi 0000534910
Length 160
Year Adopted 2007
Sequence >accession|CAA54694.1|Allergen 1-Sc1 [Betula pendula]
MGVFDYEGETTSVIPAARLFKAFILDGDNLIPKVAPQTVSCVENIEGNGGPGTIKKITFP
EGSPFKYVKERVDEVDHVNFKYSYSVIEGGAVGDTLEKICNEIKIVPAPGGGSILKISNK
YHTKGNHEMKAEQIKASKEKAEALFRAVESYLLAHSDAYN