Powered by FoodRisk.org

Allergen

CAA54695.1

Accession CAA54695.1
Species Betula pendula
Common Name European white birch
Description 1 Sc2 [Betula pendula]
Gi 0000534900
Length 159
Year Adopted 2007
Sequence >accession|CAA54695.1|Allergen 1 Sc2 [Betula pendula]
GVFDYEGETTSVIPAARLFKAFILDGDNLIPKVAPQAVSCVENIEGNGGPGTIKKITFPE
GSPFKYVKERVDEVDRVNFKYSYSVIEGGAVGDTLEKICNEIKIVPAPGGGSILKISNKY
HTKGNHEMKAEQIKASKEKAEALFRAVESYLLAHSDAYN