Powered by FoodRisk.org

Allergen

CAA54696.1

Accession CAA54696.1
Species Betula pendula
Common Name European white birch
Description 1 Sc-3 [Betula pendula]
Gi 0000534898
Length 160
Year Adopted 2007
Sequence >accession|CAA54696.1|Allergen 1 Sc-3 [Betula pendula]
MGVFNYEDEATSVIAPARLFKSFVLDADNLIPKVAPENVSSAENIEGNGGPGTIKKITFP
EGSHFKYMKHRVDEIDHANFKYCYSIIEGGPLGDTLEKISYEIKIVAAPGGGSILKITSK
YHTKGDISLNEEEIKAGKEKGAGLFKAVENYLVAHPNAYN