Powered by FoodRisk.org

Allergen

CAA55009.1

Accession CAA55009.1
Species Prunus dulcis
Common Name Almond
Description amandin, 11S globulin legumin-like protein
IUIS Name Pru du 6
Gi
Length 551
Year Adopted 2021
Sequence >CAA55009.1 Allergen Pru du 6; amandin, 11S globulin legumin-like protein [Prunus dulcis]
MAKAFVFSLCLLLVFNGCLAARQSQLSPQNQCQLNQLQAREPDNRIQAEA
GQIETWNFNQGDFQCAGVAASRITIQRNGLHLPSYSNAPQLIYIVQGRGV
LGAVFSGCPETFEESQQSSQQGRQQEQEQERQQQQQGEQGRQQGQQEQQQ
ERQGRQQGRQQQEEGRQQEQQQGQQGRPQQQQQFRQLDRHQKTRRIREGD
VVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFYLAGNPEN
EFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLL
AQALNVNEETARNLQGQNDNRNQIIQVRGNLDFVQPPRGRQEREHEERQQ
EQLQQERQQQGEQLMANGLEETFCSLRLKENIGNPERADIFSPRAGRIST
LNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQV
VNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFIN
TLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQQRRAV
V
Parent Accession
Notes This record replaces Accession: 3EHK_A from previous COMPARE versions (duplicate; CAA55009.1 is a longer version of 3EHK_A