Allergen

CAA55067.2

Accession CAA55067.2
External DB Link NCBI Protein
Species Cladosporium herbarum
Common Name fungus
Description acidic ribosomal protein P2
IUIS Name Cla h 5
Length 111
Year Adopted 2010
Sequence >CAA55067.2 Cla h 5 acidic ribosomal protein P2 [Cladosporium herbarum]
MKYLAAFLLLGLAGNSSPSAEDIKTVLSSVGIDADEERLSSLLKELEGKDINELISSGSE
KLASVPSGGAGAASAGGAAAAGGAAEAAPEAERAEEEKEESDDDMGFGLFD
Parent Accession

Related Articles

Pubmed Authors Title Journal
7814877 Zhang,L.; Muradia,G.; Curran,I.H.; Rode,H.; Vijay,H.M. A cDNA clone coding for a novel allergen, Cla h III, of Cladosporium herbarum identified as a ribosomal P2 protein J. Immunol. 154 (2), 710-717 (1995)
7898496 Achatz,G.; Oberkofler,H.; Lechenauer,E.; Simon,B.; Unger,A.; Kandler,D.; Ebner,C.; Prillinger,H.; Kraft,D.; Breitenbach,M. Molecular cloning of major and minor allergens of Alternaria alternata and Cladosporium herbarum Mol. Immunol. 32 (3), 213-227 (1995)
12102004 Breitenbach M; Simon-Nobbe B The allergens of Cladosporium herbarum and Alternaria alternata. Chem Immunol. 2002;81:48-72