Allergen

CAA55071.2

Accession CAA55071.2
Species Alternaria alternata
Common Name Fungus
Description aldehyde dehydrogenase
IUIS Name Alt a 10
Gi 0076666767
Length 497
Year Adopted 2007
Sequence >CAA55071.2 Allergen Alt a 10; aldehyde dehydrogenase [Alternaria alternata]
MTSVKLSTPQTGEFEQPTGLFINNEFVKAVDGKTFDVINPSTEEVICSVQEATEKDVDIA
VAAARKAFNGPWRKETPENRGKLLNKLADLFEKNADLIAAVEALDNGKAFSMAKNVDVPA
AAGCLRYYGGWADKIEGKVVDTAPDSFNYIRKEPIGVCGQIIPWNFPILMWSWKIGPAIA
TGNTVVLKTAEQTPLSAYIACKLIQEAGFPPGVINVITGFGKIAGAAMSAHMDIDKIAFT
GSTVVGRQIMKSAAGSNLKKVTLELGGKSPNIVFADADLDEAIHWVNFGIYFNHGQACCA
GSRIYVQEEIYDKFIQRFKERAAQNAVGDPFAADTFQGPQVSQLQFDRIMGYIEEGKKSG
ATIETGGNRKGDKGYFIEPTIFSNVTEDMKIQQEEIFGPVCTISKFKTKADVIKIGNNTT
YGLAAAVHTSNLTTAIEVANALRAGTVWVNSYNTLHWQLPFGGYKESGIGRELGEAALDN
YIQTKTVSIRLGDVLFG
Parent Accession