Allergen

CAA67128.1

Accession CAA67128.1
Species Triticum aestivum
Common Name bread wheat
Description beta-amylase
IUIS Name Tri a 17
Gi
Length 503
Year Adopted 2020
Sequence >CAA67128.1 Allergen Tri a 17; beta-amylase [Triticum aestivum]
MAGNMLANYVQVYVMLPLDVVSVDNKFEKGDEIRAQLKKLTEAGVDGVMIDVWWGLVEGK
GPKAYDWSAYKQVFDLVHEAGLKLQAIMSFHQCGGNVGDVVNIPIPQWVRDVGATDPDIF
YTNRGGTRNIEYLTLGVDDQPLFHGRTAVQMYADYMASFRENMKKFLDAGTIVDIEVGLG
PAGEMRYPSYPQSQGWVFPGIGEFICYDKYLEADFKAAAAKAGHPEWELPDDAGEYNDTP
EKTQFFKDNGTYLTEKGKFFLSWYSNKLIKHGDKILDEANKVFLGCRVQLAIKISGIHWW
YRVPNHAAELTAGYYNLDDRDGYRTIARMLTRHHASMNFTCAEMRDSEQSEEAKSAPEEL
VQQVLSAGWREGLHVACENALGRYDATAYNTILRNARPKGINKNGPPEHKLFGFTYLRLS
NELLEGQNYATFQTFVEKMHANLGHDPSVDPVAPLERSKPEMPIEMILKAAQPKLEPFPF
DKNTDLPVKDHTDVGDEVLVAPV
Parent Accession