Powered by FoodRisk.org

Allergen

CAA69670.1

Accession CAA69670.1
Species Cynodon dactylon
Common Name Bermuda grass
Description profilin
IUIS Name Cyn d 12
Gi 0002154730
Length 131
Year Adopted 2007
Sequence >CAA69670.1 Allergen Cyn d 12; profilin [Cynodon dactylon]
MSWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFL
APTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIE
KLGDYLIEQGM
Parent Accession