Allergen

CAA76556.1

Accession CAA76556.1
External DB Link NCBI Protein
Species Phleum pratense
Common Name common timothy
Description unknown function
IUIS Name Phl p 6
Length 138
Year Adopted 2007
Sequence >CAA76556.1 Phl p 6; unknown function [Phleum pratense]
MAAHKFMVAMFLAVAVVLGLATSPTAEGGKATTEEQKLIEDINASFRAAMATTANVPPAD
KYKTFEAAFTVSSKRNLADAVSKAPQLVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSE
ALHIIAGTPEVHAVKPGA
Parent Accession

Related Articles

Pubmed Authors Title Journal
10553075 Vrtala,S.; Fischer,S.; Grote,M.; Vangelista,L.; Pastore,A.; Sperr,W.R.; Valent,P.; Reichelt,R.; Kraft,D.; Valenta,R.; Molecular, immunological, and structural characterization of Phl p 6, a major allergen and P-particle-associated protein from Timothy grass (Phleum pratense) pollen J. Immunol. 163 (10), 5489-5496 (1999)
7647586 Petersen A; Bufe A; Schramm G; Schlaak M; Becker WM Characterization of the allergen group VI in timothy grass pollen (Phl p 6). II. cDNA cloning of Phl p 6 and structural comparison to grass group V. Int Arch Allergy Immunol. 1995 Sep;108(1):55-9