Powered by FoodRisk.org

Allergen

CAA76831.1

Accession CAA76831.1
Species Alnus glutinosa
Common Name Alder
Description pollen allergen Aln g 4 [Alnus glutinosa]
IUIS Name
Gi 0003319651
Length 85
Year Adopted 2007
Sequence >CAA76831.1 Allergen pollen allergen Aln g 4 [Alnus glutinosa]
MADDHPQDQAEHERIFKCFDANGDGKISASELGDALKTLGSVTPDEVKHMMAEIDTDGDG
FISFQEFTNFARANRGLVKDVAKIF
Parent Accession