Allergen

CAA76831.1

Accession CAA76831.1
Species Alnus glutinosa
Common Name Alder
Description calcium-binding protein, polcalcin
IUIS Name Aln g 4
Gi 0003319651
Length 85
Year Adopted 2007
Sequence >CAA76831.1 Allergen Aln g 4; calcium-binding protein, polcalcin [Alnus glutinosa]
MADDHPQDQAEHERIFKCFDANGDGKISASELGDALKTLGSVTPDEVKHMMAEIDTDGDG
FISFQEFTNFARANRGLVKDVAKIF
Parent Accession