Powered by FoodRisk.org

Allergen

CAB03715.1

Accession CAB03715.1
Species Daucus carota
Common Name Carrot
Description pathogenesis-related protein /PR-10 /Bet v 1 -like protein
IUIS Name Dau c 1
Gi 0002154732
Length 154
Year Adopted 2007
Sequence >CAB03715.1 Allergen Dau c 1; pathogenesis-related protein /PR-10 /Bet v 1 -like protein [Daucus carota]
MGAQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEVKGDGGAGTVRIITLPE
GSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIF
HTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN
Parent Accession