Powered by FoodRisk.org

Allergen

CAC05582.1

Accession CAC05582.1
Species Juniperus ashei
Common Name Mountain cedar
Description pollen major allergen 2 protein [Juniperus ashei]
IUIS Name
Gi 0009955725
Length 507
Year Adopted 2007
Sequence >CAC05582.1 Putative pollen major allergen 2 protein [Juniperus ashei]
MSMKFMAALAFLALQLIVMAAGEDQSAQIMLDSDTKQYHRSSRNLRKRVHHARHDVAIVF
NVEHYGAVGDGKHDSTDAFEKTWNAACNKLSAVFLVPANKKFVVNNLVFYGPCQPHFSFK
VDGTIAAYPDPAKWKNSKIWMHFARLTDFNLMGTGVIDGQGNRWWSDQCKTINGRTVCND
KGRPTAIKIDFSKSVTVKELTLTNSPEFHLVFGECDGVKIQGIKIKAPRDSPNTDGIDIF
ASKRFEIEKCTIGTGDDCVAVGTGSSNITIKDLTCGPGHGMSIGSLGKGNSRSEVSFVHL
DGAKFIDTQNGLRIKTWQGGSGLASHITYENVEMINAENPILINQFYCTSAAACKNQRSA
VKIQDVTFKNIHGTSATTAAIQLMCSDSVPCSNIKLSNVFLKLTSGKVATCVNKNANGYY
TNPLNPSCKSLHPGRTPKELELHQKPTTLLMDEKMGASLNSSPPNCKNKCKGCQPCKPKL
IIVHPNQPEDYYPQRWVCSCHNKIYNP
Parent Accession