Powered by FoodRisk.org

Allergen

CAC86258.1

Accession CAC86258.1
Species Fragaria x ananassa
Common Name Strawberry
Description lipid transfer protein (LTP) type 1
IUIS Name Fra a 3
Gi 0018477856
Length 117
Year Adopted 2015
Sequence >CAC86258.1 Allergen Fra a 3; lipid transfer protein (LTP) type 1 [Fragaria x ananassa]
MASSTAMKLSLVALLCIVVALPIAQAITCGQVASNISPCLTYVKSGGAVPAACCSGIRNL
NGMAKTTADRQAACNCLKQAAGGIKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAVK
Parent Accession