Allergen

CAD56944.1

Accession CAD56944.1
Species Apis mellifera
Common Name Honeybee
Description vitellogenin
IUIS Name Api m 12
Gi 0029329817
Length 1770
Year Adopted 2015
Sequence >CAD56944.1 Allergen Api m 12; vitellogenin [Apis mellifera]
MLLLLTLLLFAGTVAADFQHNWQVGNEYTYLVRSRTLTSLGDLSDVHTGILIKALLTVQA
KDSNVLAAKVWNGQYARVQQSMPDGWETEISDQMLELRDLPISGKPFQIRMKHGLIRDLI
VDRDVPTWEVNILKSIVGQLQVDTQGENAVKVNSVQVPTDDEPYASFKAMEDSVGGKCEV
LYDIAPLSDFVIHRSPELVPMPTLKGDGRHMEVIKIKNFDNCDQRINYHFGMTDNSRLEP
GTNKNGKFFSRSSTSRIVISESLKHFTIQSSVTTSKMMVSPRLYDRQNGLVLSRMNLTLA
KMEKTSKPLPMVDNPESTGNLVYIYNNPFSDVEERRVSKTAMNSNQIVSDNSLSSSEEKL
KQDILNLRTDISSSSSSISSSEENDFWQPKPTLEDAPQNSLLPNFVGYKGKHIGKSGKVD
VINAAKELIFQIANELEDASNIPVHATLEKFMILCNLMRTMNRKQISELESNMQISPNEL
KPNDKSQVIKQNTWTVFRDAITQTGTGPAFLTIKEWIERGTTKSMEAANIMSKLPKTVRT
PTDSYIRSFFELLQNPKVSNEQFLNTAATLSFCEMIHNAQVNKRSIHNNYPVHTFGRLTS
KHDNSLYDEYIPFLERELRKAHQEKDSPRIQTYIMALGMIGEPKILSVFEPYLEGKQQMT
VFQRTLMVGSLGKLTETNPKLARSVLYKIYLNTMESHEVRCTAVFLLMKTNPPLSMLQRM
AEFTKLDTNRQVNSAVKSTIQSLMKLKSPEWKDLAKKARSVNHLLTHHEYDYELSRGYID
EKILENQNIITHMILNYVGSEDSVIPRILYLTWYSSNGDIKVPSTKVLAMISSVKSFMEL
SLRSVKDRETIISAAEKIAEELKIVPEELVPLEGNLMINNKYALKFFPFDKHILDKLPTL
ISNYIEAVKEGKFMNVNMLDTYESVHSFPTETGLPFVYTFNVIKLTKTSGTVQAQINPDF
AFIVNSNLRLTFSKNVQGRVGFVTPFEHRHFISGIDSNLHVYAPLKISLDVNTPKGNMQW
KIWPMKGEEKSRLFHYSVVPFVSNHDILNLRPLSMEKGTRPMIPDDNTSLALPKNEGPFR
LNVETAKTNEEMWELIDTEKLTDRLPYPWTMDNERYVKVDMYMNLEGEQKDPVIFSTSFD
SKVMTRPDTDSENWTPKMMAVEPTDKQANSKTRRQEMMREAGRGIESAKSYVVDVRVHVP
GESESETVLTLAWSESNVESKGRLLGFWRVEMPRSNADYEVCIGSQIMVSPETLLSYDEK
MDQKPKMDFNVDIRYGKNCGKGERIDMNGKLRQSPRLKELVGATSIIKDCVEDMKRGNKI
LRTCQKAVVLSMLLDEVDISMEVPSDALIALYSQGLFSLSEIDNLDVSLDVSNPKNAGKK
KIDVRAKLNEYLDKADVIVNTPIMDAHFKDVKLSDFGFSTEDILDTADEDLLINNVFYED
ETSCMLDKTRAQTFDGKDYPLRLGPCWHAVMTTYPRINPDNHNEKLHIPKDKSVSVLSRE
NEAGQKEVKVLLGSDKIKFVPGTTSQPEVFVNGEKIVVSRNKAYQKVEENEIIFEIYKMG
DRFIGLTSDKFDVSLALDGERVMLKASEDYRYSVRGLCGNFDHDSTNDFVGPKNCLFRKP
EHFVASYALISNQCEGDSLNVAKSLQDHDCIRQERTQQRNVISDSESGRLDTEMSTWGYH
HNVNKHCTIHRTQVKETDDKICFTMRPVVSCASGCTAVETKSKPYKFHCMEKNEAAMKLK
KRIEKGANPDLSQKPVSTTEELTVPFVCKA
Parent Accession